PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011073189.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family ARF
Protein Properties Length: 845aa    MW: 94280.8 Da    PI: 6.5516
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011073189.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.99.6e-24144245199
                     EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSE CS
              B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrse 89 
                     f+k+lt sd++++g +++ +++a+e+      + + + +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + ++
  XP_011073189.1 144 FCKTLTASDTSTHGGFSVLRRHADEClppldmSRQ-PPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGEN 235
                     99*****************************7333.34459************************************************..4499 PP

                     E..EEEEE-S CS
              B3  90 felvvkvfrk 99 
                     +el+v+v+r+
  XP_011073189.1 236 GELRVGVRRA 245
                     99*****996 PP

2Auxin_resp124.76.2e-41270352183
      Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                     a+ha++tk++F+v+Y+Pr+s+seF+v+++++++++k+++s+GmRfkm+fe+e+++e+r++Gt+vg++d+dp rWp+SkWr+Lk
  XP_011073189.1 270 AWHAIQTKTMFTVYYKPRTSPSEFIVPYDQYMESVKNNYSIGMRFKMRFEGEEAPEQRFTGTIVGIEDADPKRWPESKWRCLK 352
                     89*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.101.3E-41140259IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019362.22E-40140273IPR015300DNA-binding pseudobarrel domain
CDDcd100177.64E-22142244No hitNo description
SMARTSM010192.0E-23144246IPR003340B3 DNA binding domain
PROSITE profilePS5086312.012144246IPR003340B3 DNA binding domain
PfamPF023621.1E-21144245IPR003340B3 DNA binding domain
PfamPF065074.0E-38270352IPR010525Auxin response factor
PfamPF023093.2E-11700809IPR033389AUX/IAA domain
SuperFamilySSF542777.19E-12716796No hitNo description
PROSITE profilePS5174523.164719801IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 845 aa     Download sequence    Send to blast
MSASEVSIKG YNNDCNDYSS GTDKGNSGAG KVDAETALYT ELWRACAGPL VTVPREHELV  60
YYFPQGHIEQ VEASTNQSAD QQMPVYNLPP KILCRVVNVH LKAEPDTDEV FAQVTLMPEP  120
NQDENAVKKE PLPAPPPRFH VHSFCKTLTA SDTSTHGGFS VLRRHADECL PPLDMSRQPP  180
TQELVAKDLH GNEWRFRHIF RGQPRRHLLQ SGWSVFVSSK RLVAGDAFIF LRGENGELRV  240
GVRRAMRQQG NAPSSVISSH SMHLGVLATA WHAIQTKTMF TVYYKPRTSP SEFIVPYDQY  300
MESVKNNYSI GMRFKMRFEG EEAPEQRFTG TIVGIEDADP KRWPESKWRC LKVRWDETST  360
IPRPERVSPW KIEPALSPPA LNPLPVPRPK RPRSSVLPSS PDSSVLTREG PSKMAVDPSP  420
ASGFPRVLQG QELSTLRGTF AESNESESSE KPLLWNPSLD SEKIDASASR RYGSDKWLPI  480
GRPEKSFTDL LSGFGSQNNS SNDFCMSPVN QEVSKLQAQE HEAKFSLIGN TWSIMPSGLS  540
LNLMDSGLKT HGQGADSSYQ RRGDARYATF REFSLIPDPR GDNQQGNWLM PPPISPYLQM  600
PSSQSRELMP KSVFAQPHDT MKPKEGNCKL FGIPLISNSA SLEPALSHRT AMTEPAGHVQ  660
HGIRSHQSLA IESDQRSDQS KGSKVVDNPV ATTEQEKQFQ TFHPVARDRE SKGHSGSTRS  720
CTKVHKQGTA LGRSVDLSKF DNYDELIAEL DNLFEFNGEL KARNKNWLVV YTDDEDDMML  780
VGDDPWEEFC GMVRKILILT KEEVQRMSPG TFNSKGEETS SVAEGMDAKD VKDLPKTSSS  840
SPDDC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-1743737418354Auxin response factor 1
4ldw_A1e-1743737418354Auxin response factor 1
4ldw_B1e-1743737418354Auxin response factor 1
4ldx_A1e-1743737418354Auxin response factor 1
4ldx_B1e-1743737418354Auxin response factor 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011073189.10.0PREDICTED: auxin response factor 2-like
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLA0A022Q1X60.0A0A022Q1X6_ERYGU; Auxin response factor
STRINGPGSC0003DMT4000367650.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA26182444
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2